nelk831 nelk831

03-11-2020
Mathematics

contestada

Complete the equation.
5x + 5x = 10x

Complete the equation 5x 5x 10x class=

Respuesta :

quhana09 quhana09

03-11-2020

Answer:

10x2

Step-by-step explanation:

jfdcwfghngkkgfffddnmkhcfhgfegvchnujffghjj

Answer Link

eekram512 eekram512

03-11-2020

Answer:

may be 1

Step-by-step explanation:

5x+5x=10x

so the answer must be 1

Answer Link

Otras preguntas

a meter stick casts a shadow 1.4 m long at the same time a flagpole casts a shadow 7.7 m long. The triangle formed by the meterstick and its shadow is similar t

Why was nature so important to Anne Frank? (The Diary of Anne Frank) Please help!!!

Identify true statements. (a) A sequence is either arithmetic or geometric. (b) An arithmetic sequence is either increasing or decreasing if common difference i

The school concert raised $1360 from the sale of 400 tickets. If adult tickets cost $5 and student tickets $3, how many student tickets were sold?How many stude

what did anna sofia nysten do after the titanic sinking

You can divide any parallelogram into two matching triangles. How is this useful?i need to know this answer right now please

How many electrons are in a carbon 13 (13c) atom?

What is a federal scout

How many hawksbill turtles are left in the world?

Name two things found in a plant cell that are not found in an animal cell.